Anti-FBXO5 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FBXO5 (F-box protein 5). It is part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FBXO5 in human samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Rabbit polyclonal antibody targeting human FBXO5
- Validated application: Western blot (WB)
- Immunogen derived from a defined human protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- FBXO5 (F-box protein 5)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- EENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for Western blot detection of FBXO5 in human-derived samples. It may support studies of FBXO5 expression and protein size in research contexts. The manufacturer does not provide validation data for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
