Anti-FLII Rabbit
Overview
This rabbit polyclonal antibody is generated against a protein sequence from human FLII (flightless I homolog, Drosophila). It is supplied as part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FLII protein in human samples. The manufacturer reports validation of this antibody for Western blot applications.
Highlights
- Rabbit polyclonal antibody targeting human FLII
- Validated application: Western blot (WB)
- Immunogen derived from a defined human protein sequence
- Formulated in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- FLII (flightless I homolog, Drosophila)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of FLII in human-derived samples. It may be applied in research examining FLII protein expression and molecular weight. The manufacturer does not report validation for applications beyond Western blotting.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
