Anti-FOXA3 Antibody
Overview
This antibody is raised against a protein sequence from human FOXA3 (forkhead box A3). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FOXA3 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human FOXA3
- Validated application: immunocytochemistry (ICC)
- Immunogen based on a defined FOXA3 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- FOXA3 (forkhead box A3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of FOXA3 in human-derived cell samples. It may be used in research examining FOXA3 localisation and expression at the cellular level. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
