Anti-GADD45G Antibody
Overview
This antibody is raised against a protein sequence from human GADD45G (growth arrest and DNA-damage-inducible, gamma). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GADD45G in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human GADD45G
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GADD45G protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GADD45G (growth arrest and DNA-damage-inducible, gamma)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GADD45G in human tissue sections. It may be used in research examining GADD45G expression and cellular localisation. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
