Anti-GATA2 Antibody
Overview
This antibody is raised against a protein sequence from human GATA2 (GATA binding protein 2). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GATA2 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human GATA binding protein 2
- Validated application: Western blot (WB)
- Immunogen based on a defined GATA2 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GATA2 (GATA binding protein 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GATA2 in human-derived samples. It may be used in research investigating GATA2 expression and relative protein abundance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
