Anti-GCN1 Antibody
Overview
This antibody is raised against a protein sequence from human GCN1 (GCN1 eIF2 alpha kinase activator homolog). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GCN1 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human GCN1
- Validated application: Western blot (WB)
- Immunogen derived from a defined GCN1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GCN1 (GCN1 eIF2 alpha kinase activator homolog)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- ALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEATRSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFC
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GCN1 in human-derived samples. It may be used in research investigating translational control and cellular stress response pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
