Anti-HOXB7 Antibody
Overview
This antibody is raised against a protein sequence from human HOXB7 (homeobox B7). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous HOXB7 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human HOXB7
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined HOXB7 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- HOXB7 (homeobox B7)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of HOXB7 in human-derived cell samples. It may be used in research examining homeobox transcription factor localisation and expression. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.


