Anti-LHX2 Antibody
Overview
This antibody is raised against a protein sequence from human LHX2 (LIM homeobox 2). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous LHX2 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human LIM homeobox 2
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined LHX2 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- LHX2 (LIM homeobox 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYN
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of LHX2 in human-derived cell samples. It may be used in research examining LIM homeobox transcription factors and developmental gene regulation. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

