Anti-MLH1 Antibody
Overview
This antibody is raised against a protein sequence from human MLH1 (MutL homolog 1), a key component of the DNA mismatch repair pathway. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MLH1 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human MutL homolog 1 (MLH1)
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined MLH1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MLH1 (MutL homolog 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- IATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of MLH1 in human-derived cell samples. It may be used in research examining DNA mismatch repair mechanisms and genome stability. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

