Anti-MSMP Antibody
Overview
This antibody is raised against a protein sequence from human MSMP (microseminoprotein, prostate associated). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MSMP in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human microseminoprotein, prostate associated
- Validated application: Western blot (WB)
- Immunogen derived from a defined MSMP protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MSMP (microseminoprotein, prostate associated)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- FTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of MSMP in human-derived samples. It may be used in research examining prostate-associated secreted proteins and their biological roles. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

