Anti-NPAT Antibody
Overview
This antibody is raised against a protein sequence from human NPAT (nuclear protein, ataxia-telangiectasia locus), a nuclear protein involved in cell cycle regulation and histone gene transcription. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NPAT in human-derived cell samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human nuclear protein at the ataxia-telangiectasia locus (NPAT)
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined NPAT protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NPAT (nuclear protein, ataxia-telangiectasia locus)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of NPAT in human-derived cell samples. It may be used in research examining cell cycle progression, DNA damage response, and regulation of histone gene expression. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
