Anti-NSUN3 Antibody
Overview
This antibody is raised against a protein sequence from human NSUN3 (NOP2/Sun domain family member 3), a mitochondrial RNA methyltransferase involved in post-transcriptional modification of mitochondrial tRNAs. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NSUN3 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human NSUN3 (NOP2/Sun domain family member 3)
- Validated application: Western blot (WB)
- Immunogen derived from a defined NSUN3 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NSUN3 (NOP2/Sun domain family member 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- PGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDAQPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NSUN3 in human-derived samples. It may be used in research investigating mitochondrial RNA processing, RNA methylation, and mitochondrial gene expression. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
