Anti-NTNG1 Antibody
Overview
This antibody is raised against a defined protein sequence from human NTNG1 (netrin G1), a glycosylphosphatidylinositol-anchored protein involved in axon guidance and synaptic organisation in the nervous system. It forms part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NTNG1 in human-derived cellular samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human netrin G1 (NTNG1)
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined NTNG1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NTNG1 (netrin G1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of NTNG1 in human-derived cells. It may be used in research investigating neuronal development, axon guidance, and synaptic connectivity. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
