Anti-NUP188 Antibody
Overview
This antibody is raised against a defined protein sequence from human NUP188 (nucleoporin 188 kDa), a structural component of the nuclear pore complex involved in nucleocytoplasmic transport. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NUP188 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human nucleoporin 188 kDa (NUP188)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined NUP188 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NUP188 (nucleoporin 188 kDa)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- YFSALILVEGMDIESLHKCALDDRRELHQFAQDGLICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGGTAIQLNVFQYLTRLLQSLASGGNDCTTSTACMCVYGLLS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of NUP188 in human tissue sections. It may be used in research examining nuclear pore complex architecture, nucleocytoplasmic transport, and nuclear envelope organisation. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
