Anti-PEA15 Antibody
Overview
This antibody targets human PEA15 (phosphoprotein enriched in astrocytes 15), a cytoplasmic protein involved in signal transduction and regulation of apoptosis. It is generated against a defined PEA15-derived immunogen sequence and is supplied as part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation of this antibody for immunocytochemistry.
Highlights
- Recognises human phosphoprotein enriched in astrocytes 15 (PEA15)
- Validated application: Immunocytochemistry (ICC)
- Immunogen derived from a defined PEA15 protein sequence
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PEA15 (phosphoprotein enriched in astrocytes 15)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- DKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of PEA15 in human-derived cells. It may support research into intracellular signalling pathways and apoptosis-related processes. Validation has not been reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
