Anti-PIP4K2B Antibody
Overview
This antibody targets human phosphatidylinositol-5-phosphate 4-kinase type II beta (PIP4K2B), a lipid kinase involved in phosphoinositide signalling and cellular membrane dynamics. It is generated against a defined PIP4K2B-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Recognises human phosphatidylinositol-5-phosphate 4-kinase type II beta (PIP4K2B)
- Validated application: Western blot (WB)
- Immunogen based on a defined PIP4K2B protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PIP4K2B (phosphatidylinositol-5-phosphate 4-kinase, type II, beta)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PIP4K2B in human-derived samples. It may be applied in studies of phosphoinositide metabolism and intracellular signalling pathways. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
