Anti-PTPN1 Antibody
Overview
This antibody targets human PTPN1 (protein tyrosine phosphatase non-receptor type 1), a cytosolic phosphatase involved in regulation of receptor tyrosine kinase signalling and metabolic pathways. It is generated against a defined PTPN1-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals portfolio. The manufacturer reports validation exclusively for Western blot analysis.
Highlights
- Recognises human protein tyrosine phosphatase PTPN1
- Validated application: Western blot (WB)
- Immunogen derived from a defined PTPN1 protein region
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PTPN1 (protein tyrosine phosphatase, non-receptor type 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PTPN1 in human-derived samples. It may support studies of tyrosine phosphorylation signalling, insulin receptor pathways, and phosphatase-mediated regulation. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
