Anti-RETSAT Antibody
Overview
This antibody recognises human retinol saturase (RETSAT), an enzyme involved in retinoid metabolism. It is raised against a defined immunogen sequence to enable selective protein detection. The antibody is supplied in liquid format.
Highlights
- Targets human RETSAT protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Retinol saturase (RETSAT)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- SSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFSANQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPM
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of RETSAT in human samples. It supports research into retinoid metabolism and enzymatic pathways.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
