Anti-RHOT2 Antibody
Overview
This antibody targets human ras homolog family member T2 (RHOT2), a mitochondrial GTPase involved in mitochondrial trafficking and dynamics. It is generated using a sequence-defined immunogen to support selective detection. The antibody is supplied as a liquid reagent.
Highlights
- Targets human RHOT2 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Ras homolog family member T2 (RHOT2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of RHOT2 in human-derived samples. It supports studies of mitochondrial transport and cellular energy regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
