Anti-ROBO2 Antibody
Overview
This antibody recognises human roundabout homolog 2 (ROBO2), an axon guidance receptor involved in neuronal development and cell migration. It is raised against a defined immunogen sequence to support selective protein detection. The antibody is supplied in liquid format.
Highlights
- Targets human ROBO2 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Roundabout homolog 2 (ROBO2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of ROBO2 in human samples. It supports research into axon guidance, neuronal signalling, and cell migration.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
