Anti-G3BP2 Antibody
Overview
This antibody is raised against a protein sequence from human G3BP2 (GTPase activating protein (SH3 domain) binding protein 2). It is part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous G3BP2 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human G3BP2
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined G3BP2 protein sequence
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- G3BP2 (GTPase activating protein (SH3 domain) binding protein 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of G3BP2 in human tissue sections. It may be used in research investigating G3BP2 localisation and expression patterns. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
