
Product Details
- Manufacturer
- Atlas Antibodies
- SKU
- HPA005727WB
- Shipped From
- Sweden
About this product
Anti-TRIP13 Polyclonal Antibody, 100 µL
Overview
This polyclonal antibody is raised against the human thyroid hormone receptor interactor 13 (TRIP13) protein and is designed for use in immunodetection workflows. The antibody is generated in rabbit and affinity purified using a recombinant Protein Epitope Signature Tag (PrEST) antigen. It is supplied as an unconjugated IgG preparation in a buffered solution suitable for laboratory research applications.
The product has been validated for Western blot analysis, including demonstrated reactivity in human cell lines such as HeLa. Its defined antigen sequence enables selective recognition of TRIP13, a protein associated with cellular processes including chromosome segregation and DNA repair.
Highlights
- Rabbit-derived polyclonal IgG targeting human TRIP13 protein
- Affinity purified using recombinant PrEST antigen
- Validated for Western blot (WB) applications
- Unconjugated format מאפשר flexible downstream detection methods
At-a-glance
- Target
- TRIP13 (thyroid hormone receptor interactor 13)
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Application
- Western blot (WB)
- Conjugate
- Unconjugated
- Purification
- Affinity purified using PrEST antigen
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence
- STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH
- Reactivity
- Human
- Cross-reactivity
- Mouse (88%), Rat (89%)
- Buffer Composition
- 40% glycerol in PBS (pH 7.2) with 0.02% sodium azide
- Volume
- 100 µL
- Condition
- New / Unused
Applications
This antibody is suitable for the detection and analysis of TRIP13 protein expression in human-derived samples using Western blotting techniques. It may support studies investigating protein function in cell cycle regulation, DNA repair pathways, and oncogenic processes.
The defined antigen specificity enables its use in comparative expression studies and validation of TRIP13-related molecular findings in research settings.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
Related Products
What Our Clients Say
Supporting innovation at leading research companies

RNAnalytics
Leading The Way In Gene Therapy Analytics
As a startup focused on developing analytical toolkits for LNP characterization, RNAnalytics operates under tight budget constraints while striving to maintain a fully stocked lab with high-quality materials. Sustainability is also a core pillar of our operations, pushing us to make environmentally conscious decisions wherever possible....