Anti-FAM83H Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FAM83H (family with sequence similarity 83, member H). It is part of Atlas Antibodies’ Triple A Polyclonals portfolio and is intended for detection of endogenous FAM83H protein in human samples. According to the manufacturer, this antibody has been validated for use in Western blot analysis.
Highlights
- Rabbit polyclonal antibody targeting human FAM83H
- Validated application: Western blot (WB)
- Immunogen based on a defined human protein sequence
- Supplied in buffered glycerol solution for laboratory use
At-a-glance
- Target protein
- FAM83H (family with sequence similarity 83, member H)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for the detection of FAM83H in human-derived samples using Western blotting. It may be used in studies investigating FAM83H expression and protein size in research settings. No validation is provided by the manufacturer for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
