Anti-FBXL14 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody is generated against a protein sequence from human FBXL14 (F-box and leucine-rich repeat protein 14). It belongs to the Atlas Antibodies Triple A Polyclonals portfolio and is designed for detection of endogenous FBXL14 in human samples. According to the manufacturer, this antibody has been validated for Western blot analysis.
Highlights
- Rabbit polyclonal antibody targeting human FBXL14
- Validated application: Western blot (WB)
- Immunogen derived from a defined human protein sequence
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- FBXL14 (F-box and leucine-rich repeat protein 14)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of FBXL14 in human-derived samples. It may be used in research investigating FBXL14 protein expression and relative abundance. No manufacturer validation is provided for applications beyond Western blotting.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
