Anti-FDFT1
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FDFT1 (farnesyl-diphosphate farnesyltransferase 1). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is designed for detection of endogenous FDFT1 in human samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Rabbit polyclonal antibody targeting human FDFT1
- Validated application: Western blot (WB)
- Immunogen based on a defined human protein sequence
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- FDFT1 (farnesyl-diphosphate farnesyltransferase 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of FDFT1 in human-derived samples. It may be used in research investigating FDFT1 expression and relative protein levels. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
