Anti-FLNC
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FLNC (filamin C, gamma). It is supplied within the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FLNC in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Rabbit polyclonal antibody targeting human FLNC
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined human protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- FLNC (filamin C, gamma)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of FLNC in human tissue sections. It may be used in research studies examining FLNC localisation and expression patterns. Validation for applications other than IHC is not reported by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
