Anti-FN1 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FN1 (fibronectin 1). It forms part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FN1 protein in human samples. According to the manufacturer, this antibody has been validated exclusively for Western blot analysis.
Highlights
- Rabbit polyclonal antibody targeting human fibronectin 1
- Validated application: Western blot (WB)
- Immunogen based on a defined FN1 protein sequence
- Supplied in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- FN1 (fibronectin 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of fibronectin 1 in human-derived samples. It may be used in research examining FN1 expression and protein size. No validation data are provided by the manufacturer for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
