Anti-FOXJ1 Antibody
Overview
This antibody is raised against a protein sequence from human FOXJ1 (forkhead box J1). It is supplied within the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FOXJ1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human FOXJ1
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined FOXJ1 protein sequence
- Formulated in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- FOXJ1 (forkhead box J1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of FOXJ1 in human tissue sections. It may support research investigating FOXJ1 localisation and expression patterns. Validation for applications beyond immunohistochemistry is not reported by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
