Anti-FOXR2 Antibody
Overview
This antibody is raised against a protein sequence from human FOXR2 (forkhead box R2). It is supplied as part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FOXR2 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human FOXR2
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined FOXR2 protein sequence
- Formulated in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- FOXR2 (forkhead box R2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- CEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWM
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of FOXR2 in human tissue sections. It may be used in research examining FOXR2 localisation and expression patterns. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
