Anti-FTL Antibody
Overview
This antibody is raised against a protein sequence from human FTL (ferritin light polypeptide). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FTL in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human ferritin light polypeptide
- Validated application: immunohistochemistry (IHC)
- Immunogen based on a defined FTL protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- FTL (ferritin light polypeptide)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of FTL in human tissue sections. It may be used in research investigating ferritin light chain localisation and expression. Validation for applications beyond immunohistochemistry is not reported by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
