Anti-FUBP3 Antibody
Overview
This antibody is raised against a protein sequence from human FUBP3 (far upstream element binding protein 3). It is supplied as part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FUBP3 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human FUBP3
- Validated application: Western blot (WB)
- Immunogen derived from a defined FUBP3 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- FUBP3 (far upstream element binding protein 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of FUBP3 in human-derived samples. It may be used in research investigating FUBP3 expression and relative protein levels. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
