Anti-FUNDC1 Antibody
Overview
This antibody is raised against a protein sequence from human FUNDC1 (FUN14 domain containing 1). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FUNDC1 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human FUNDC1
- Validated application: Western blot (WB)
- Immunogen derived from a defined FUNDC1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- FUNDC1 (FUN14 domain containing 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of FUNDC1 in human-derived samples. It may be used in research examining FUNDC1 expression and relative protein abundance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
