Anti-GAMT Antibody
Overview
This antibody is raised against a protein sequence from human GAMT (guanidinoacetate N-methyltransferase). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GAMT in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human guanidinoacetate N-methyltransferase
- Validated application: Western blot (WB)
- Immunogen based on a defined GAMT protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GAMT (guanidinoacetate N-methyltransferase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GAMT in human-derived samples. It may be used in research investigating GAMT expression and relative protein abundance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
