Anti-GCDH Antibody
Overview
This antibody is raised against a protein sequence from human GCDH (glutaryl-CoA dehydrogenase). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GCDH in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human glutaryl-CoA dehydrogenase
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GCDH protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GCDH (glutaryl-CoA dehydrogenase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- QYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYH
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GCDH in human tissue sections. It may be used in research examining GCDH localisation and expression patterns. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
