Anti-GCLC Antibody
Overview
This antibody is raised against a protein sequence from human GCLC (glutamate-cysteine ligase, catalytic subunit). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GCLC in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human glutamate-cysteine ligase catalytic subunit
- Validated application: Western blot (WB)
- Immunogen derived from a defined GCLC protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GCLC (glutamate-cysteine ligase, catalytic subunit)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GCLC in human-derived samples. It may be used in research investigating antioxidant metabolism and glutathione biosynthesis pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
