Anti-GCM1 Antibody
Overview
This antibody is raised against a protein sequence from human GCM1 (glial cells missing homolog 1, Drosophila). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GCM1 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human GCM1
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined GCM1 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GCM1 (glial cells missing homolog 1, Drosophila)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of GCM1 in human-derived cell samples. It may be used in research examining GCM1 localisation and expression at the cellular level. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
