Anti-GDF15 Antibody
Overview
This antibody is raised against a protein sequence from human GDF15 (growth differentiation factor 15). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GDF15 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human growth differentiation factor 15
- Validated application: Western blot (WB)
- Immunogen derived from a defined GDF15 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GDF15 (growth differentiation factor 15)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GDF15 in human-derived samples. It may be used in research examining GDF15 expression and relative protein abundance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
