Anti-GOT2 Antibody
Overview
This antibody is raised against a protein sequence from human GOT2 (glutamic-oxaloacetic transaminase 2, mitochondrial). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GOT2 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human mitochondrial GOT2
- Validated application: Western blot (WB)
- Immunogen derived from a defined GOT2 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GOT2 (glutamic-oxaloacetic transaminase 2, mitochondrial)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GOT2 in human-derived samples. It may be used in research examining mitochondrial amino acid metabolism and transaminase activity. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
