Anti-GPCPD1 Antibody
Overview
This antibody is raised against a protein sequence from human GPCPD1 (glycerophosphocholine phosphodiesterase 1, also known as GDE1 homolog). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GPCPD1 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human GPCPD1 (GDE1 homolog)
- Validated application: Western blot (WB)
- Immunogen derived from a defined GPCPD1 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GPCPD1 (glycerophosphocholine phosphodiesterase 1)
- Alternative names
- GDE5, GDPD6, KIAA1434
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- DGMWDGNLSTYFDMNLFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRSRTTPIAMSFAQFENLLGINVHTEDLLRNPSYIQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GPCPD1 in human-derived samples. It may be used in research investigating glycerophospholipid metabolism and related enzymatic pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
