Anti-GPR65 Antibody
Overview
This antibody is raised against a protein sequence from human GPR65 (G protein-coupled receptor 65). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GPR65 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human G protein-coupled receptor 65
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined GPR65 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GPR65 (G protein-coupled receptor 65)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of GPR65 in human-derived cell samples. It may be used in research examining GPCR localisation and expression at the cellular level. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
