Anti-GUSB Antibody
Overview
This antibody is raised against a protein sequence from human GUSB (glucuronidase, beta). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GUSB in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human beta-glucuronidase
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GUSB protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GUSB (glucuronidase, beta)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GUSB in human tissue sections. It may be used in research examining lysosomal enzyme localisation and expression. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
