Anti-KIAA1429 Antibody
Overview
This antibody is raised against a protein sequence from human KIAA1429. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous KIAA1429 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human KIAA1429
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined KIAA1429 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- KIAA1429
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of KIAA1429 in human tissue sections. It may be used in research examining RNA methylation–associated protein complexes. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
