Anti-KMT2C Antibody
Overview
This antibody is raised against a protein sequence from human KMT2C (lysine (K)-specific methyltransferase 2C). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous KMT2C in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human KMT2C
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined KMT2C protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- KMT2C (lysine (K)-specific methyltransferase 2C)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of KMT2C in human-derived cell samples. It may be used in research examining chromatin modification and transcriptional regulation. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
