Anti-LIMCH1 Antibody
Overview
This antibody recognises human LIM and calponin homology domains-containing protein 1 (LIMCH1), a cytoskeletal-associated protein implicated in actin dynamics. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human LIMCH1 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- LIM and calponin homology domains 1 (LIMCH1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV
- Validated applications
- WB (SKU: HPA063840WB); IHC (SKU: HPA063840IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of LIMCH1 in human samples by western blot or immunohistochemistry. Supports studies of cytoskeletal organisation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
