Anti-MGLL Antibody
Overview
This antibody is raised against a protein sequence from human MGLL (monoglyceride lipase). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MGLL in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human monoglyceride lipase
- Validated application: Western blot (WB)
- Immunogen derived from a defined MGLL protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MGLL (monoglyceride lipase)
- Alternative gene names
- HU-K5, MGL
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHE
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of MGLL in human-derived samples. It may be used in research examining lipid metabolism and endocannabinoid signalling pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
