Anti-MYCL Antibody
Overview
This antibody is raised against a protein sequence from human MYCL (v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MYCL in human-derived cell samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human MYCL transcription factor
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined MYCL protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MYCL (v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of MYCL in human-derived cell samples. It may be used in research examining MYC family transcription factors and their roles in cell proliferation and oncogenic signalling. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
