Anti-NCR3LG1 Antibody
Overview
This antibody is raised against a protein sequence from human NCR3LG1 (natural killer cell cytotoxicity receptor 3 ligand 1), a ligand involved in immune cell interactions. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NCR3LG1 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human NCR3LG1
- Validated application: Western blot (WB)
- Immunogen derived from a defined NCR3LG1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NCR3LG1 (natural killer cell cytotoxicity receptor 3 ligand 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- TPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFY
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NCR3LG1 in human-derived samples. It may be used in research examining immune recognition mechanisms and natural killer cell signalling pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
