Anti-NECTIN1 Antibody
Overview
This antibody is raised against a protein sequence from human NECTIN1 (nectin cell adhesion molecule 1), an immunoglobulin-like adhesion molecule involved in cell–cell junction formation. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NECTIN1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human nectin cell adhesion molecule 1
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined NECTIN1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NECTIN1 (nectin cell adhesion molecule 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of NECTIN1 in human tissue sections. It may be used in research examining cell–cell adhesion, epithelial junctions, and tissue architecture. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
