Anti-NFE2L3 Antibody
Overview
This antibody is raised against a protein sequence from human NFE2L3 (nuclear factor, erythroid 2-like 3), a transcription factor belonging to the CNC-bZIP family. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NFE2L3 in human-derived cell samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human nuclear factor, erythroid 2-like 3
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined NFE2L3 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NFE2L3 (nuclear factor, erythroid 2-like 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of NFE2L3 in human-derived cell samples. It may be used in research examining transcriptional regulation, oxidative stress responses, and erythroid-related signalling pathways. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
