Anti-NNMT Antibody
Overview
This antibody is raised against a protein sequence from human NNMT (nicotinamide N-methyltransferase), a cytosolic enzyme involved in nicotinamide metabolism and cellular methylation pathways. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NNMT in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human nicotinamide N-methyltransferase (NNMT)
- Validated application: Western blot (WB)
- Immunogen derived from a defined NNMT protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NNMT (nicotinamide N-methyltransferase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NNMT in human-derived samples. It may be used in research examining cellular metabolism, methylation processes, and metabolic reprogramming. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

